1.-9. (canceled)
10. A pump for delivering a liquid, comprising:
a pump housing having at least one inlet and at least one outlet;
an eccentric arranged rotatably in the pump housing;
a deformable diaphragm that surrounds the eccentric
at least one delivery path from the at least one inlet to the at least one outlet delimited by the deformable diaphragm and the pump housing;
at least one seal that is displaceable along the at least one delivery path by way of a movement of the eccentric; and
a spring layer arranged between the eccentric and the deformable diaphragm.
11. The pump as claimed in claim 10, further comprising a seal arranged between the outlet and the inlet and configured to prevent a flow of the liquid from the outlet to the inlet counter to a delivery direction.
12. The pump as claimed in claim 10, wherein the deformable diaphragm has a first spring constant in a radial direction proceeding from an axis of rotation of the eccentric, and the spring layer has a second spring constant in the radial direction, wherein the second spring constant is lower than the first spring constant.
13. The pump as claimed in claim 12, wherein the deformable diaphragm comprises a polymer material that swells at least in part due to the liquid such that at least one of a thickness and a spring constant of the deformable diaphragm in the radial direction changes.
14. The pump as claimed in claim 10, further comprising:
a sealing ply arranged between the deformable diaphragm and the spring layer that prevents an ingress of the liquid from the deformable diaphragm into the spring layer.
15. The pump as claimed in claim 10, wherein the spring layer comprises a plurality of spring elements arranged between the deformable diaphragm and the eccentric.
16. The pump as claimed in claim 10, wherein the spring layer comprises an elastic material arranged between the deformable diaphragm and the eccentric.
17. The pump as claimed in claim 10,
wherein the eccentric has an outer bearing ring and an inner eccentric section, and
wherein, at least one bearing is arranged between the inner eccentric section and the outer bearing ring and configured to convert a rotational movement of the inner eccentric section into an eccentric wobbling movement of the outer bearing ring.
18. The pump as claimed in claim 10, wherein the spring layer is configured to brace the eccentric and the deformable diaphragm against one another.
19. A motor vehicle comprising:
an internal combustion engine;
an exhaust-gas treatment device configured to purify exhaust gases of the internal combustion engine;
a tank in which a liquid for exhaust-gas purification is stored; and
a pump for delivering the liquid to the exhaust-gas treatment device, comprising:
a pump housing having at least one inlet and at least one outlet;
an eccentric arranged rotatably in the pump housing;
a deformable diaphragm that surrounds the eccentric
at least one delivery path from the at least one inlet to the at least one outlet delimited by the deformable diaphragm and the pump housing;
at least one seal that is displaceable along the at least one delivery path by way of a movement of the eccentric; and
a spring layer arranged between the eccentric and the deformable diaphragm configured to brace the eccentric and the deformable diaphragm against one another.
The claims below are in addition to those above.
All refrences to claim(s) which appear below refer to the numbering after this setence.
1. A peptide having the amino acid sequence
H2NX1RX2COOH(formula I)
wherein
X1 is either zero or
X1 andor X2 are a residue representing at least five amino acid residues (symbolized in the one letter amino acid code), preferably naturally occurring amino acids,
with the proviso that
X1 andor X2 contain at least one basic amino acid residue immediately followed by a hydrophobic amino acid residue and X1 andor X2 contain at least one glutamine residue.
2. The peptide according to claim 1 wherein
X1 represents XmKBXn wherein
X is any amino acid residue having at least one Q.
B is any hydrophobic amino acid residue;
m0-40, n0-8 and X2 is Q.
3. The peptide according to claim 1 wherein
X1 is zero or represents Q.
X2 represents XnKBXm,
X, B, m and n having the same meaning as defined in claim 2.
4. The peptide according to claim 1 wherein
X1 represents XmKBXn and
X2 represents XnKBXm,
X,B,m, and n have the same meanings as defined in claim 2.
5. The peptide according to any one of claims 1-4, having D- andor L-amino acids.
6. The peptide according to anyone of the claims 1-5, having the structures
KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK (Casocidin 1-39)
TKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK (Casocidin 2-39)
KNRLNFLKKISQRYQKFALPQYLKTVYQHQK (Casocidin 9-39)
RYQKFALPQYLKTVYQHQK (Casocidin 21-39)
KNRLNFLKKISQRYQ (Casocidin 9-23).
7. The peptide according to anyone of the claims 1-6 being chemically modified in the amino acid side chains andor the amino group of the N-terminal end has been modified with electrophilic reagents andor the carboxyl moiety of the C-terminal end of the peptide has been modified with nucleophilic reagents.
8. Fragments of the peptides according to anyone of the claims 1-7, obtainable by proteolytic cleavage with proteases, which fragments show antifungal andor antibiotic effects.
9. A medicament comprising at least one of the peptides according to any one of the claims 1-8 in an effective amount for treating diseases, optionally in a mixture with further active compounds and or carrier materials or adjuvants.
10. The medicament of claim 9 formulated for topical administration or administration on mucosa.
11. The medicament of claims 9 for treating of fungal diseases, andor treatment of diseases caused by eukaryotic organisms such as trichomonades in vagina, or organisms as filaria or plasmodium.
12. A process for the manufacturing of a peptide according to claim 1-8 comprising the steps
treating bovine milk with acetic acid and calcium sulfate,
heating the mixture obtained
removing the precipitate and isolating the super- natant,
treating the supernatant with a cation-exchanger resin for binding of basic peptides, washing the resin optionally with a urea solution to remove non specifically bound material,
isolating the resin having peptides bound to it,
elution of peptides bound to the resin and further purification with chromatographic operations,
optionally followed by fragmentation, e.g. by digestion with proteases.
13. A method of treating of diseases by administering a medicament of claim 9 or 11 in an effective amount to a patient in need thereof.
14. The method of claim 13 wherein the disease is diarrhoea, diseases caused by a change of the microbiological properties or conditions in the intestine, the mucosa of the vagina or the mouth, diseases of the skin and diseases caused by fungi.
15. Method of using a peptide according to any one of the claims 1-8. as preservative of food or perishable goods or as adjuvant for fermentation processes.
16. Method of using a peptide according to any one of the claims 1-8 for the manufacturing of a medicament according to claims 9-11.
17. A peptide having the amino acid sequence
H2NX1RX2COOH(formula I)
wherein,
X1 is either zero or
X1 andor X2 are a residue representing at least five amino acid residues (symbolized in-the one letter amino acid code), preferably naturally occurring amino acids,
with the proviso that
X1 andor X2 contain at least one basic amino acid residue immediately followed by a hydrophobic amino acid residue and X1 andor X2 contain at least one glutamine residue.
with the proviso that
X1 does not represent: KTKLTEEEKNRLNFLKKISQ
X2 does not represent: TKLTEEEKNRLNFLKKISQ.
18. The peptide according to claim 17 wherein
X1 represents XmKBXn wherein
X is any amino acid residue having at least one Q.
B is any hydrophobic amino acid residue;
m0-40, n0-8 and
X2 is Q.
19. The peptide according to claim 17 wherein
X1 is zero or represents Q.
X2 represents XnKBXm,
X, B. m and n having the same meaning as defined in claim 18.
20. The peptide according to claim 17 wherein
X1 represents XmKBXn and
X2 represents XnKBXm,
X,B,m, and n have the same meanings as defined in claim 18.
21. The peptide according to any one of claims 17-20, having D- andor L-amino acids.
22. The peptide according to anyone of the claims 17-21, having the structures
KNRLNFLKKISQRYQKFALPQYLKTVYQHQK (Casocidin 9-39)
RYQKFALPQYLKTVYQHQK (Casocidin 21-39)
KNRLNFLKKISQRYQ (Casocidin 9-23).
23. The peptide according to anyone of the claims 17-22 being chemically modified in the amino acid side chains andor the amino group of the N-terminal end has been modified with electrophilic reagents andor the carboxyl moiety of the C-terminal end of the peptide has been modified with nucleophilic reagents.
24. Fragments of the peptides according to anyone of the claims 17-23, obtainable by proteolytic cleavage with proteases, which fragments show antifungal andor antibiotic effects.
25. A medicament comprising at least one of the peptides according to any one of the claims 17-24 in an effective amount for treating diseases, optionally in a mixture with further active compounds and or carrier materials or adjuvants.
26. The medicament of claim 25 formulated for topical administration or administration on mucosa.
27. The medicament of claims 25 for treating of fungal diseases, andor treatment of diseases caused by eukaryotic organisms such as trichomonades in vagina, or organisms as filaria or plasmodium.
28. A process for the manufacturing of a peptide according to claim 17-24 comprising the steps
treating bovine milk with acetic acid and calcium sulfate,
heating the mixture obtained
removing the precipitate and isolating the super-natant,
treating the supernatant with a cation-exchanger resin for binding of basic peptides, washing the resin optionally with a urea solution to remove non specifically bound material,
isolating the resin having peptides bound to it,
elution of peptides bound to the resin and further purification with chromatographic operations,
followed by fragmentation, e.g. by digestion with proteases.
29. A method of treating of diseases by administering a medicament of claim 25 or 27 in an effective amount to a patient in need thereof.
30. The method of claim 29 wherein the disease is diarrhoea, diseases caused by a change of the microbiological properties or conditions in the intestine, the mucosa of the vagina or the mouth, diseases of the skin and diseases caused by fungi.
31. Method of using a peptide according to any one of the claims 17-24 as preservative of food or perishable goods or as adjuvant for fermentation processes.
32. Method of using a peptide according to any one of the claims 17-24 for the manufacturing of a medicament according to claims 25-27.