Author: claimsbot

1. A high site density glutathione derivatized flow cytometer bead comprising glutathione molecules covalently linked through a crosslinking agent to a polymeric bead, said bead having a diameter ranging from about 1 microns to about 30 microns, said bead having a high site binding density.
2. The derivatized flow cytometer bead according to claim 1 wherein said binding site density of said bead ranges from about 7.5\xd7103 binding sites\u03bcm2 to about 5\xd7105 binding sites\u03bcm2.
3. The derivatized flow cytometer bead according to claim 1 wherein said binding site density of said bead ranges from about 1\xd7104 binding sites\u03bcm2 to about 1\xd7105 binding sites\u03bcm2.
4. The derivatized flow cytomer bead according to claim 1 wherein said binding site density of said bead ranges from about 1\xd7104 binding sites\u03bcm2 to about 5\xd7104 binding sites\u03bcm2.
5. The derivatized flow cytometer bead according to claim 1 wherein said crosslinking agent is linked to said polymeric bead through a hydroxyl group or an amine group on said polymer bead.
6. The derivatized flow cytometer bead according to claim 1 wherein said crosslinking agent has two electrophilic groups or an electrophilic group and a nucleophilic group.
7. The derivatized flow cytometer bead according to claim 6 wherein said crosslinking agent has two electrophilic groups.
8. The derivatized flow cytometer bead according to claim 1 wherein said crosslinking agent is a bis-epoxide crosslinking agent.
9. The derivatived flow cytometer bead according to claim 7 wherein said crosslinking agent is 1,4-butanediyl diglyciyl ether.
10. The derivatized flow cytometer bead according to claim 7 wherein said crosslinking agent is succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) or sulfosuccinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (Sulfo-SMCC).
11. The derivatized flow cytometer bead according to claim 7 wherein said crosslinking agent is SMCC.
12. The derivatized flow cytometer bead having a diameter of about 3 microns to about 10 microns.
13. The derivatized flow cytometer bead wherein said polymeric bead comprises a polymeric material selected from the group consisting of amino-polystyrene, latex, polycarbohydrate and glass.
14. The derivatized flow cytometer bead according to claim 1 wherein said polymeric bead comprises a crosslinked agarose-dextran composite (Superdex).
15. The derivatized flow cytometer bead according to claim 13 wherein said polymeric material is amino-polystyrene.
16. The derivatized flow cytometer bead according to claim 1 further comprising a GST-fusion protein bound thereto.
17. The derivatized flow cytometer bead according to claim 16 wherein said GST fusion protein comprises GST and a fused protein.
18. The derivatized flow cytometer bead according to claim 17 wherein said fused protein is Bcl-2 protein.
19. The derivatized flow cytometer bead according to claim 17 wherein said fused protein is bound to a binding partner of said protein.
20. The derivatized flow cytometer bead according to claim 17 wherein said binding partner is a protein, peptide, DNA, RNA or a small molecule.
21. The derivatized flow cytometer bead according to claim 17 wherein said fused protein is a Bcl-2 protein.
22. The derivatized flow cytometer bead according to claim 21 wherein said Bcl-2 protein is Bcl-2, Bcl-XL, Bfl-1, Mcl-1, Bcl-W or Bcl-B.
23. The derivatized flow cytometer bead according to claim 19 wherein said fused protein is a Bcl-2 protein.
24. The derivatized flow cytometer bead according to claim 23 wherein said fused protein is Bcl-2, Bcl-XL, Bfl-1, Mcl-1, Bcl-W or Bcl-B.
25. The derivatized flow cytometer bead according to claim 19 wherein said binding partner is fluorescently labeled.
26. The derivatized flow cytometer bead according to claim 25 wherein said binding partner is a fluorescently labeled peptide.
27. The derivatized flow cytometer bead according to claim 26 wherein said peptide is a BH3 peptide based upon sequences found in Bcl-2 proteins.
28. The derivatized flow cytometer bead according to claim 27 wherein said peptide is a Bim BH3 peptide.
29. The derivatized flow cytometer bead according to claim 27 wherein said peptide is a Bid BH3 peptide.
30. The derivatized flow cytometer bead according to claim 27 wherein said peptide is a PUMA BH3 peptide.
31. The derivatized flow cytometer bead according to claim 27 wherein said peptide is a Bak BH3 peptide.
32. The derivatized flow cytometer bead according to claim 19 where said fused protein is a Bcl-2 protein and said binding partner is FITC conjugated epigallocachechin (ECGC).
33. The derivatized flow cytometer bead according to claim 19 wherein said fused protein is a GTPase.
34. The derivatized flow cytometer bead according to claim 33 wherein said GTPase is a Rab, Rac, Rho, Cdc42 or Ras GTPase.
35. The derivatized flow cytometer bead according to claim 34 wherein said binding partner is GTP.
36. The derivatized flow cytometer bead according to claim 34 wherein said GTPase is a Rab GTPase.
37. The derivatized flow cytometer bead according to claim 36 wherein said binding partner is HVps150, hVps34 or a myotubularin.

The claims below are in addition to those above.
All refrences to claim(s) which appear below refer to the numbering after this setence.

I claim:

1. An auxiliary device for moving a payload receptacle of an elevator, comprising: an auxiliary drive device coupleable with a drive unit for the payload receptacle; means for limiting speed of the pay load receptacle; and an image transmission device arranged for sight-free visualization of one of a movable component of the drive unit and a movable component of the speed limiting means, the image transmission device comprising a sensor for detecting images representing movement of one of the drive unit and the speed limiting means, display device for visualization of the images detected by the sensor, and a transfer path connected between the sensor and the display device for transferring the images detected by the sensor to the display device.
2. An auxiliary device according to claim 1, wherein the sensor is a first mirror oriented towards one of the drive unit and the speed limiting means, and the display device is a second mirror, and the second mirror being oriented towards the first mirror so as to form the transfer path.
3. An auxiliary device according to claim 1, wherein the transfer path is a conductor connection.
4. An auxiliary device according to claim 1, wherein the sensor is a camera, the display device is a monitor, and the transfer path is an electric conductor connection.
5. An auxiliary device according to claim 1, wherein the sensor is operative to detect images of the movement of a rotating rotary element connected with the drive unit.
6. An auxiliary device according to claim 5, wherein the rotary element is a shaft of the drive unit, the sensor is a tachometer element arranged at the shaft, and the display device is a tacho display.
7. An auxiliary device according to claim 5, wherein the rotary element is a drive pulley of the drive unit, the pulley having light-permeable zones arranged at mutual angular spacings along a circle arranged concentrically with a rotational axis of the pulley, the image transmission device further including a light source arranged on one side of the rotary element, the sensor being arranged on an opposite side of the rotary element so as to sense light emitted by the light source.
8. An auxiliary device according to claim 7, wherein the light source and the sensor are elements of a light barrier and the transfer path is an electric conductor connection.
9. An auxiliary device according to claim 7, wherein the sensor is an input of an optical conductor arrangement, the conductor connection is the optical conductor arrangement and the display is an output of the optical conductor arrangement.
10. An auxiliary device according to claim 1, and further comprising an emitter and a receiver, the sensor being coupled with the emitter, the display device being coupled with the receiver and the transfer path being one of a radio connection and a laser light connection.
11. A device for monitoring position and movement of a cage in a shaft of an elevator, comprising: first means for monitoring the movement of the cage, which first means includes a unit for detection of the movement, a data transmission path and a display unit; and second means for monitoring the position of the cage, which second means includes means for reproducing the position of the cage.
12. A device according to claim 11, and further comprising a drive unit for movement of the cage, the unit for detection of the movement of the cage being operative to enable a conclusion about the movement of the cage to be made by way of a detection of the movement of a movable part of the drive unit.
13. A device according to claim 11, and further comprising speed-limiting means for limiting cage speed, the unit for detection of the movement of the cage being operative to enable a conclusion about the movement of the cage to be made by way of detection of movement of a movable part of the speed-limiting means.
14. A device according to claim 12, wherein the unit for detection of the movement of the cage comprises a flexible shaft connected with the movable part of the drive unit, the display unit including one of a rotating disc and a tachometer.
15. A device according to claim 13, wherein the unit for detection of the movement of the cage comprises a flexible shaft connected with the movable part of the speed-limiting unit, the display unit including one of a rotating disc and a tachometer.
16. A device according to claim 13, wherein the speed-limiting means includes a cable, the means for reproducing the position of the cage including marks at the cable of the speed-limiting means.
17. A device according to claim 11, and further comprising support means for supporting the cage, the means for reproducing the position of the cage including marks at the support means.

1.-9. (canceled)
10. A pump for delivering a liquid, comprising:
a pump housing having at least one inlet and at least one outlet;
an eccentric arranged rotatably in the pump housing;
a deformable diaphragm that surrounds the eccentric
at least one delivery path from the at least one inlet to the at least one outlet delimited by the deformable diaphragm and the pump housing;
at least one seal that is displaceable along the at least one delivery path by way of a movement of the eccentric; and
a spring layer arranged between the eccentric and the deformable diaphragm.
11. The pump as claimed in claim 10, further comprising a seal arranged between the outlet and the inlet and configured to prevent a flow of the liquid from the outlet to the inlet counter to a delivery direction.
12. The pump as claimed in claim 10, wherein the deformable diaphragm has a first spring constant in a radial direction proceeding from an axis of rotation of the eccentric, and the spring layer has a second spring constant in the radial direction, wherein the second spring constant is lower than the first spring constant.
13. The pump as claimed in claim 12, wherein the deformable diaphragm comprises a polymer material that swells at least in part due to the liquid such that at least one of a thickness and a spring constant of the deformable diaphragm in the radial direction changes.
14. The pump as claimed in claim 10, further comprising:
a sealing ply arranged between the deformable diaphragm and the spring layer that prevents an ingress of the liquid from the deformable diaphragm into the spring layer.
15. The pump as claimed in claim 10, wherein the spring layer comprises a plurality of spring elements arranged between the deformable diaphragm and the eccentric.
16. The pump as claimed in claim 10, wherein the spring layer comprises an elastic material arranged between the deformable diaphragm and the eccentric.
17. The pump as claimed in claim 10,
wherein the eccentric has an outer bearing ring and an inner eccentric section, and
wherein, at least one bearing is arranged between the inner eccentric section and the outer bearing ring and configured to convert a rotational movement of the inner eccentric section into an eccentric wobbling movement of the outer bearing ring.
18. The pump as claimed in claim 10, wherein the spring layer is configured to brace the eccentric and the deformable diaphragm against one another.
19. A motor vehicle comprising:
an internal combustion engine;
an exhaust-gas treatment device configured to purify exhaust gases of the internal combustion engine;
a tank in which a liquid for exhaust-gas purification is stored; and
a pump for delivering the liquid to the exhaust-gas treatment device, comprising:
a pump housing having at least one inlet and at least one outlet;
an eccentric arranged rotatably in the pump housing;
a deformable diaphragm that surrounds the eccentric
at least one delivery path from the at least one inlet to the at least one outlet delimited by the deformable diaphragm and the pump housing;
at least one seal that is displaceable along the at least one delivery path by way of a movement of the eccentric; and
a spring layer arranged between the eccentric and the deformable diaphragm configured to brace the eccentric and the deformable diaphragm against one another.

The claims below are in addition to those above.
All refrences to claim(s) which appear below refer to the numbering after this setence.

1. A peptide having the amino acid sequence
H2NX1RX2COOH(formula I)
wherein
X1 is either zero or
X1 andor X2 are a residue representing at least five amino acid residues (symbolized in the one letter amino acid code), preferably naturally occurring amino acids,
with the proviso that
X1 andor X2 contain at least one basic amino acid residue immediately followed by a hydrophobic amino acid residue and X1 andor X2 contain at least one glutamine residue.
2. The peptide according to claim 1 wherein
X1 represents XmKBXn wherein
X is any amino acid residue having at least one Q.
B is any hydrophobic amino acid residue;
m0-40, n0-8 and X2 is Q.
3. The peptide according to claim 1 wherein
X1 is zero or represents Q.
X2 represents XnKBXm,
X, B, m and n having the same meaning as defined in claim 2.
4. The peptide according to claim 1 wherein
X1 represents XmKBXn and
X2 represents XnKBXm,
X,B,m, and n have the same meanings as defined in claim 2.
5. The peptide according to any one of claims 1-4, having D- andor L-amino acids.
6. The peptide according to anyone of the claims 1-5, having the structures
KTKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK (Casocidin 1-39)
TKLTEEEKNRLNFLKKISQRYQKFALPQYLKTVYQHQK (Casocidin 2-39)
KNRLNFLKKISQRYQKFALPQYLKTVYQHQK (Casocidin 9-39)
RYQKFALPQYLKTVYQHQK (Casocidin 21-39)
KNRLNFLKKISQRYQ (Casocidin 9-23).
7. The peptide according to anyone of the claims 1-6 being chemically modified in the amino acid side chains andor the amino group of the N-terminal end has been modified with electrophilic reagents andor the carboxyl moiety of the C-terminal end of the peptide has been modified with nucleophilic reagents.
8. Fragments of the peptides according to anyone of the claims 1-7, obtainable by proteolytic cleavage with proteases, which fragments show antifungal andor antibiotic effects.
9. A medicament comprising at least one of the peptides according to any one of the claims 1-8 in an effective amount for treating diseases, optionally in a mixture with further active compounds and or carrier materials or adjuvants.
10. The medicament of claim 9 formulated for topical administration or administration on mucosa.
11. The medicament of claims 9 for treating of fungal diseases, andor treatment of diseases caused by eukaryotic organisms such as trichomonades in vagina, or organisms as filaria or plasmodium.
12. A process for the manufacturing of a peptide according to claim 1-8 comprising the steps
treating bovine milk with acetic acid and calcium sulfate,
heating the mixture obtained
removing the precipitate and isolating the super- natant,
treating the supernatant with a cation-exchanger resin for binding of basic peptides, washing the resin optionally with a urea solution to remove non specifically bound material,
isolating the resin having peptides bound to it,
elution of peptides bound to the resin and further purification with chromatographic operations,
optionally followed by fragmentation, e.g. by digestion with proteases.
13. A method of treating of diseases by administering a medicament of claim 9 or 11 in an effective amount to a patient in need thereof.
14. The method of claim 13 wherein the disease is diarrhoea, diseases caused by a change of the microbiological properties or conditions in the intestine, the mucosa of the vagina or the mouth, diseases of the skin and diseases caused by fungi.
15. Method of using a peptide according to any one of the claims 1-8. as preservative of food or perishable goods or as adjuvant for fermentation processes.
16. Method of using a peptide according to any one of the claims 1-8 for the manufacturing of a medicament according to claims 9-11.
17. A peptide having the amino acid sequence
H2NX1RX2COOH(formula I)
wherein,
X1 is either zero or
X1 andor X2 are a residue representing at least five amino acid residues (symbolized in-the one letter amino acid code), preferably naturally occurring amino acids,
with the proviso that
X1 andor X2 contain at least one basic amino acid residue immediately followed by a hydrophobic amino acid residue and X1 andor X2 contain at least one glutamine residue.
with the proviso that
X1 does not represent: KTKLTEEEKNRLNFLKKISQ
X2 does not represent: TKLTEEEKNRLNFLKKISQ.
18. The peptide according to claim 17 wherein
X1 represents XmKBXn wherein
X is any amino acid residue having at least one Q.
B is any hydrophobic amino acid residue;
m0-40, n0-8 and
X2 is Q.
19. The peptide according to claim 17 wherein
X1 is zero or represents Q.
X2 represents XnKBXm,
X, B. m and n having the same meaning as defined in claim 18.
20. The peptide according to claim 17 wherein
X1 represents XmKBXn and
X2 represents XnKBXm,
X,B,m, and n have the same meanings as defined in claim 18.
21. The peptide according to any one of claims 17-20, having D- andor L-amino acids.
22. The peptide according to anyone of the claims 17-21, having the structures
KNRLNFLKKISQRYQKFALPQYLKTVYQHQK (Casocidin 9-39)
RYQKFALPQYLKTVYQHQK (Casocidin 21-39)
KNRLNFLKKISQRYQ (Casocidin 9-23).
23. The peptide according to anyone of the claims 17-22 being chemically modified in the amino acid side chains andor the amino group of the N-terminal end has been modified with electrophilic reagents andor the carboxyl moiety of the C-terminal end of the peptide has been modified with nucleophilic reagents.
24. Fragments of the peptides according to anyone of the claims 17-23, obtainable by proteolytic cleavage with proteases, which fragments show antifungal andor antibiotic effects.
25. A medicament comprising at least one of the peptides according to any one of the claims 17-24 in an effective amount for treating diseases, optionally in a mixture with further active compounds and or carrier materials or adjuvants.
26. The medicament of claim 25 formulated for topical administration or administration on mucosa.
27. The medicament of claims 25 for treating of fungal diseases, andor treatment of diseases caused by eukaryotic organisms such as trichomonades in vagina, or organisms as filaria or plasmodium.
28. A process for the manufacturing of a peptide according to claim 17-24 comprising the steps
treating bovine milk with acetic acid and calcium sulfate,
heating the mixture obtained
removing the precipitate and isolating the super-natant,
treating the supernatant with a cation-exchanger resin for binding of basic peptides, washing the resin optionally with a urea solution to remove non specifically bound material,
isolating the resin having peptides bound to it,
elution of peptides bound to the resin and further purification with chromatographic operations,
followed by fragmentation, e.g. by digestion with proteases.
29. A method of treating of diseases by administering a medicament of claim 25 or 27 in an effective amount to a patient in need thereof.
30. The method of claim 29 wherein the disease is diarrhoea, diseases caused by a change of the microbiological properties or conditions in the intestine, the mucosa of the vagina or the mouth, diseases of the skin and diseases caused by fungi.
31. Method of using a peptide according to any one of the claims 17-24 as preservative of food or perishable goods or as adjuvant for fermentation processes.
32. Method of using a peptide according to any one of the claims 17-24 for the manufacturing of a medicament according to claims 25-27.